Return to main results Retrieve Phyre Job Id

Job DescriptionP25666
Confidence4.40%DateThu Jan 5 11:42:14 GMT 2012
Rank44Aligned Residues56
% Identity23%Templatec2wxoA_
PDB info PDB header:transferaseChain: A: PDB Molecule:phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic PDBTitle: the crystal structure of the murine class ia pi 3-kinase2 p110delta in complex with as5.
Resolution2.49 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   138.140.........150.........160.........170.........180.........190.........200.........210.......
Predicted Secondary structure 






































Query SS confidence 















































































Query Sequence  KTPLVAWIDFGYCHKPNVTRGLKIWDFPFDESKMHLFTIKKGLTVTSQQQVFDFMIGNHVYIIGGAIVGSQHKWKEFYKL
Query Conservation   

   


 

 

             
   

 
  
             
        
 

 
 
       
   
Alig confidence 
















.......................








.........





















Template Conservation    
 






 


  .......................  

 

  ......... 
  
   

  
  
  
   
Template Sequence  ESGQLFHIDFGHFLGNF. . . . . . . . . . . . . . . . . . . . . . . RVPFILTYD. . . . . . . . . FVHVIQQGKTNNSEKFERFRGY
Template Known Secondary structure  TTS






TT

.......................






.........TTT
S

Template Predicted Secondary structure 









.......................






.........





Template SS confidence 















































































   903......910......... 920........ .930.........940.........950
 
   218.220.....
Predicted Secondary structure 
Query SS confidence 







Query Sequence  VLESQKIT
Query Conservation         
Alig confidence 







Template Conservation 
  
   
Template Sequence  CERAYTIL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 







   960.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions