Return to main results Retrieve Phyre Job Id

Job DescriptionP25666
Confidence13.58%DateThu Jan 5 11:42:14 GMT 2012
Rank10Aligned Residues30
% Identity20%Templatec2choA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:glucosaminidase; PDBTitle: bacteroides thetaiotaomicron hexosaminidase with o-2 glcnacase activity
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.......
Predicted Secondary structure 























Query SS confidence 










































Query Sequence  GRGDWTANKGFREKLARSVDVYFSYFERLAALENEMIIFTSPD
Query Conservation 




           
  
 
      
  
 
 




   
Alig confidence 


.
............

























Template Conservation 
 
.
............
 
 

 

 
 
  










Template Sequence  GTP. W. . . . . . . . . . . . SHQARLSQLKFYGKNKMNTYIYGPKD
Template Known Secondary structure  SS
.
............
TT



TT
Template Predicted Secondary structure 


.
............








Template SS confidence 










































   138.140 . ........150.........160.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions