Return to main results Retrieve Phyre Job Id

Job DescriptionP25666
Confidence10.38%DateThu Jan 5 11:42:14 GMT 2012
Rank15Aligned Residues35
% Identity14%Templatec1jb7A_
PDB info PDB header:dna-binding protein/dnaChain: A: PDB Molecule:telomere-binding protein alpha subunit; PDBTitle: dna g-quartets in a 1.86 a resolution structure of an oxytricha nova2 telomeric protein-dna complex
Resolution1.86 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50......
Predicted Secondary structure 


























Query SS confidence 













































Query Sequence  YFDIGRGDWTANKGFREKLARSVDVYFSYFERLAALENEMIIFTSP
Query Conservation   







           
  
 
      
  
 
 




  
Alig confidence 








...........

























Template Conservation 

       ...........         
             
  
Template Sequence  FFNVKADNL. . . . . . . . . . . HKNADARKKLEDSAELLTKFNSYVDA
Template Known Secondary structure  TTSS



T...........TT
STT
Template Predicted Secondary structure 





...........






Template SS confidence 













































   443......450. ........460.........470.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions