Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFI2
Confidence25.24%DateThu Jan 5 11:26:24 GMT 2012
Rank47Aligned Residues33
% Identity21%Templated1a6qa1
SCOP infoAnother 3-helical bundle Protein serine/threonine phosphatase 2C, C-terminal domain Protein serine/threonine phosphatase 2C, C-terminal domain
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200.........210.........220.........230..
Predicted Secondary structure 
















Query SS confidence 











































Query Sequence  AQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIY
Query Conservation 
 
    
        

     







 

         
Alig confidence 












...........



















Template Conservation 
  
   
   

...........
 






 

  


   
Template Sequence  LVHVMRTLASENI. . . . . . . . . . . PSLPPGGELASKRNVIEAVY
Template Known Secondary structure  TT
...........SS

TTTGGGGG
Template Predicted Secondary structure 


...........






Template SS confidence 











































   330.........340.. .......350.........360..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions