Return to main results Retrieve Phyre Job Id

Job DescriptionP76464
Confidence25.21%DateWed Jan 25 15:21:08 GMT 2012
Rank193Aligned Residues32
% Identity25%Templatec2nn6I_
PDB info PDB header:hydrolase/transferaseChain: I: PDB Molecule:3'-5' exoribonuclease csl4 homolog; PDBTitle: structure of the human rna exosome composed of rrp41, rrp45,2 rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Resolution3.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   351........360.........370.........380.........390.
Predicted Secondary structure 























Query SS confidence 








































Query Sequence  RPLYRAGDRVDVKVIGREFHDPLHSSPIVSAPAKLSVLDAN
Query Conservation 
 







  
 
 

             

 
 
 

 
Alig confidence 

















.........













Template Conservation     
  



 




  .........       


    
Template Sequence  YKSFRPGDIVLAKVISLG. . . . . . . . . DAQSNYLLTTAENE
Template Known Secondary structure  GGT

SSS.........TTTT

SSS
Template Predicted Secondary structure 





.........






Template SS confidence 








































   119120.........130...... ...140.........150
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions