Return to main results Retrieve Phyre Job Id

Job DescriptionP37342
Confidence7.28%DateThu Jan 5 11:55:22 GMT 2012
Rank71Aligned Residues26
% Identity23%Templatec3t4aG_
PDB info PDB header:immune systemChain: G: PDB Molecule:fibrinogen-binding protein; PDBTitle: structure of a truncated form of staphylococcal complement inhibitor b2 bound to human c3c at 3.4 angstrom resolution
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   126...130.. .......140.........150.
Predicted Secondary structure 

..................



Query SS confidence 






. . . . . . . . . . . . . . . . . .


















Query Sequence  LQPYVRI. . . . . . . . . . . . . . . . . . LTQDEIDVRIKRFWRYLDR
Query Conservation 
 

 

.................. 
 


 


  
  


 
Alig confidence 






..................


















Template Conservation 








 
 
 


 






 


 

  




 



Template Sequence  LNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDE
Template Known Secondary structure  S
TTT
Template Predicted Secondary structure 

Template SS confidence 











































   38.40.........50.........60.........70.........80.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions