Return to main results Retrieve Phyre Job Id

Job DescriptionP37342
Confidence7.90%DateThu Jan 5 11:55:22 GMT 2012
Rank65Aligned Residues39
% Identity18%Templatec1sjiA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:calsequestrin, cardiac muscle isoform; PDBTitle: comparing skeletal and cardiac calsequestrin structures and2 their calcium binding: a proposed mechanism for coupled3 calcium binding and protein polymerization
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110..... ....120...
Predicted Secondary structure 




























.


Query SS confidence 



















































.







Query Sequence  HAPYKPRYVLPDYARFLANGSEWLELEGAKDLDDALSLLTILYHHVPSVTSM. PVYLGQLD
Query Conservation    
  
   
 
    
  
       

  
 

 
        
 
    .  
 



Alig confidence 







.....................






















.







Template Conservation 
 


  
.....................
   
                    
  
 

Template Sequence  YHESVSSD. . . . . . . . . . . . . . . . . . . . . KVAQKQFQLKEIVLELVAQVLEHKDIGFVMVD
Template Known Secondary structure 

S
SS.....................STTSGGGSS
Template Predicted Secondary structure 



.....................




Template SS confidence 




























































   37..40.... .....50.........60.........70......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions