Return to main results Retrieve Phyre Job Id

Job DescriptionP12008
Confidence15.97%DateThu Jan 5 11:33:05 GMT 2012
Rank28Aligned Residues31
% Identity42%Templated2za7a1
SCOP infoFerritin-like Ferritin-like Ferritin
Resolution1.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210.........220......
Predicted Secondary structure 















Query SS confidence 










































Query Sequence  DKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRL
Query Conservation       
   
  

  





 

    


 


 
 



Alig confidence 
















............













Template Conservation 
    
   
  
    ............    


  



 
Template Sequence  KLIKKMGDHLTNIQRLV. . . . . . . . . . . . GSQAGLGEYLFERL
Template Known Secondary structure  ............
Template Predicted Secondary structure 

............


Template SS confidence 










































   140.........150...... ...160.........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions