Return to main results Retrieve Phyre Job Id

Job DescriptionP12008
Confidence32.66%DateThu Jan 5 11:33:05 GMT 2012
Rank19Aligned Residues22
% Identity27%Templatec2lhuA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:mybpc3 protein; PDBTitle: structural insight into the unique cardiac myosin binding protein-c2 motif: a partially folded domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90.........100.........110.........120..
Predicted Secondary structure 





















Query SS confidence 


































Query Sequence  TDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDYRG
Query Conservation   
  
 

      






     


  
 

Alig confidence 










.............










Template Conservation    
  



 
.............   






 
Template Sequence  RQAPPSEYERI. . . . . . . . . . . . . AFQHGVTDLRG
Template Known Secondary structure  TTS
GGG.............TT


Template Predicted Secondary structure 


.............

Template SS confidence 


































   322.......330.. .......340...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions