Return to main results Retrieve Phyre Job Id

Job DescriptionP09162
Confidence6.49%DateThu Jan 5 11:02:07 GMT 2012
Rank44Aligned Residues27
% Identity26%Templatec3kw2A_
PDB info PDB header:transferaseChain: A: PDB Molecule:probable r-rna methyltransferase; PDBTitle: crystal structure of probable rrna-methyltransferase from2 porphyromonas gingivalis
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100.....
Predicted Secondary structure 












Query SS confidence 


































Query Sequence  IVVSALEMNEGGLSQVEERILHEVVAGATLMKYRQ
Query Conservation 


   
    


 

 

  
 
  


  
 
Alig confidence 


....
















....






Template Conservation 
 
....






  
   
   ....
   


Template Sequence  ILI. . . . GPEGDFSPSEVESALLA. . . . GFAPVSL
Template Known Secondary structure  ....

TT


....T


Template Predicted Secondary structure  ....







....


Template SS confidence 


































   193.. ....200.........210.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions