Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMS0
Confidence8.08%DateThu Jan 5 12:37:55 GMT 2012
Rank30Aligned Residues28
% Identity14%Templatec3pifD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:5'->3' exoribonuclease (xrn1); PDBTitle: crystal structure of the 5'->3' exoribonuclease xrn1, e178q mutant in2 complex with manganese
Resolution2.92 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80........
Predicted Secondary structure 













Query SS confidence 






































Query Sequence  YLTEDGSNLYSCIVGMQWDNGPGRYGHVIAAPARDYIDL
Query Conservation 

 
 
  
 




   
  


 




 

  



Alig confidence 




....













.......








Template Conservation 

  
....

 
     
   
.......








Template Sequence  FISER. . . . WPQISQLIDGSQIP. . . . . . . EFDNLYLDM
Template Known Secondary structure  TT....STT
SSS


.......

Template Predicted Secondary structure  ....







.......



Template SS confidence 






































   910... ......20....... ..30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions