Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMS0
Confidence5.46%DateThu Jan 5 12:37:55 GMT 2012
Rank52Aligned Residues26
% Identity27%Templatec3kewA_
PDB info PDB header:transferaseChain: A: PDB Molecule:dhha1 domain protein; PDBTitle: crystal structure of probable alanyl-trna-synthase from clostridium2 perfringens
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100.........110..
Predicted Secondary structure 















Query SS confidence 

































Query Sequence  AAPARDYIDLTLDQFPGYHNRIVAEPVESGGQLA
Query Conservation 
 

  








  
 













 
Alig confidence 


















........






Template Conservation 
        



 
 


........ 




 
Template Sequence  VKEIDGKFHVLLDQTAFFP. . . . . . . . GGGGQMG
Template Known Secondary structure  TTS



........
BTTB

Template Predicted Secondary structure 








........






Template SS confidence 

































   21........30......... 40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions