Return to main results Retrieve Phyre Job Id

Job DescriptionP76190
Confidence66.35%DateThu Jan 5 12:20:17 GMT 2012
Rank27Aligned Residues22
% Identity27%Templatec3nnlB_
PDB info PDB header:biosynthetic proteinChain: B: PDB Molecule:cura; PDBTitle: halogenase domain from cura module (crystal form iii)
Resolution2.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   205....210.........220.........230.........240..
Predicted Secondary structure 




















Query SS confidence 





































Query Sequence  ELKNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRTGQ
Query Conservation   








         








  


   
 
Alig confidence 









................











Template Conservation 
 
 





................    

 
 

 
Template Sequence  EYNLGDAFFF. . . . . . . . . . . . . . . . NKYVLHQSVPLK
Template Known Secondary structure 
B
TT
................TT




Template Predicted Secondary structure 





................








Template SS confidence 





































   213......220.. .......230....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions