Return to main results Retrieve Phyre Job Id

Job DescriptionP52132
Confidence21.71%DateThu Jan 5 12:05:37 GMT 2012
Rank2Aligned Residues34
% Identity18%Templatec3agjD_
PDB info PDB header:translation/hydrolaseChain: D: PDB Molecule:protein pelota homolog; PDBTitle: crystal structure of archaeal pelota and gtp-bound ef1 alpha complex
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   212.......220.........230.........240.........250.....
Predicted Secondary structure 





























Query SS confidence 











































Query Sequence  DESNDLWTTYQRIQENLIKGGLSGRNAKGGRTHTRAVRGIDGDV
Query Conservation 
   



 





 




  
      
  

 
  

   
Alig confidence 














..........


















Template Conservation 
  



 




  ..........

 
   
 


  
    
Template Sequence  ESEEDLWLLRITLRP. . . . . . . . . . GDVVRKRTSRDVPVGSGRK
Template Known Secondary structure 
S

T..........T


SSS

Template Predicted Secondary structure 




..........




Template SS confidence 











































   18.20.........30.. .......40.........50.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions