Return to main results Retrieve Phyre Job Id

Job DescriptionP60869
Confidence14.27%DateThu Jan 5 12:07:13 GMT 2012
Rank96Aligned Residues25
% Identity24%Templatec3pr9A_
PDB info PDB header:chaperoneChain: A: PDB Molecule:fkbp-type peptidyl-prolyl cis-trans isomerase; PDBTitle: structural analysis of protein folding by the methanococcus jannaschii2 chaperone fkbp26
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   219220.........230.........240.........250
Predicted Secondary structure 















Query SS confidence 































Query Sequence  RVGPELVAWTDGKNLRELGIYRQTGCYIERIR
Query Conservation   
 
   
 





 
          
  
 
Alig confidence 















.......








Template Conservation   
 

 






 
 .......
 


  

Template Sequence  RVLVDFNHELAGKEVK. . . . . . . YRIKIEEVV
Template Known Secondary structure 
S
TTTT

.......
Template Predicted Secondary structure 







.......
Template SS confidence 































   125....130.........140 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions