Return to main results Retrieve Phyre Job Id

Job DescriptionP52006
Confidence5.94%DateThu Jan 5 12:04:54 GMT 2012
Rank87Aligned Residues24
% Identity29%Templated2dsya1
SCOP infoTTHA1013/TTHA0281-like TTHA1013/TTHA0281-like TTHA0281-like
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40.........50........
Predicted Secondary structure 















Query SS confidence 































Query Sequence  GVFPGQWAISGGGVEPGERIEEALRREIREEL
Query Conservation      
 
  


 
  


   

 


 

 
Alig confidence 








.......






.







Template Conservation 
   

 
 .......
 




.
  
 
 
Template Sequence  PDLPGVWAT. . . . . . . GKSLKEC. EANLQAAL
Template Known Secondary structure  TTSTT
.......SS.
Template Predicted Secondary structure 



.......
.
Template SS confidence 































   34.....40.. ....... 50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions