Return to main results Retrieve Phyre Job Id

Job DescriptionP52006
Confidence4.36%DateThu Jan 5 12:04:54 GMT 2012
Rank97Aligned Residues37
% Identity19%Templatec3brcA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved protein of unknown function; PDBTitle: crystal structure of a conserved protein of unknown function from2 methanobacterium thermoautotrophicum
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50........
Predicted Secondary structure 






















Query SS confidence 

















































Query Sequence  PLIQNDGAYLLCKMADDRGVFPGQWAISGGGVEPGERIEEALRREIREEL
Query Conservation   

     


  
        
 
  


 
  


   

 


 

 
Alig confidence 




















.............















Template Conservation 
  
 






 







.............   
 


  
  


Template Sequence  VIXDSRGRLLSAAXSPPHVIH. . . . . . . . . . . . . SXEVREAVRSEXTHAL
Template Known Secondary structure  TTS


TTTS.............


Template Predicted Secondary structure 








.............
Template SS confidence 

















































   113......120.........130... ......140.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions