Return to main results Retrieve Phyre Job Id

Job DescriptionP31063
Confidence15.13%DateThu Jan 5 11:47:00 GMT 2012
Rank6Aligned Residues26
% Identity23%Templated1smpi_
SCOP infoStreptavidin-like beta-Barrel protease inhibitors Metalloprotease inhibitor
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930.........40.........50.........60.
Predicted Secondary structure 



















Query SS confidence 
































Query Sequence  PAPDWLAGYWQTKGPQRALVSPEAIGSLIVTKE
Query Conservation 


  
 
 


 


  





 





 
Alig confidence 










.......














Template Conservation 
  
 





.......
 
    
 
 
   
Template Sequence  PSAAELSGQWV. . . . . . . LSGAEQHCDIRLNTD
Template Known Secondary structure 


.......
SS
Template Predicted Secondary structure 


.......









Template SS confidence 
































   6...10...... ...20.........30.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions