Return to main results Retrieve Phyre Job Id

Job DescriptionP75864
Confidence26.35%DateThu Jan 5 12:15:14 GMT 2012
Rank407Aligned Residues31
% Identity32%Templated1qbaa1
SCOP infoImmunoglobulin-like beta-sandwich E set domains E-set domains of sugar-utilizing enzymes
Resolution1.85

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   393...... 400.........410.........420.........430...
Predicted Secondary structure  .










Query SS confidence 






.

































Query Sequence  EDYTNRL. RKNLKKFEKWARQEGIECYRLYDADLPEYNVAVD
Query Conservation    
  

. 
  
   

        








     

Alig confidence 






.







....




.

.....








Template Conservation    
  

   

 


....  

 .

..... 
 


 
 
Template Sequence  LRFANILGQRELAKLD. . . . KGGVA. YR. . . . . LPVPGARVA
Template Known Secondary structure  T....TT

.

.....



Template Predicted Secondary structure  ....



.

.....





Template SS confidence 









































   796...800.........810. ..... .. .820.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions