Return to main results Retrieve Phyre Job Id

Job DescriptionP04994
Confidence47.59%DateThu Jan 5 10:58:33 GMT 2012
Rank278Aligned Residues38
% Identity18%Templatec2pfsA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:universal stress protein; PDBTitle: crystal structure of universal stress protein from nitrosomonas2 europaea
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.........230....
Predicted Secondary structure 


















Query SS confidence 

















































Query Sequence  IVRAIELANQRNECDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVS
Query Conservation 
  

         
 


 




 


  

   




    




Alig confidence 






















............














Template Conservation      
   
     



 

 
............ 
  
      



Template Sequence  PREEIIRIAEQENVDLIVVGSHS. . . . . . . . . . . . TANSVLHYAKCDVLA
Template Known Secondary structure  TT
S

............
SS
Template Predicted Secondary structure 






............



Template SS confidence 

















































   95....100.........110....... ..120.........130..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions