Return to main results Retrieve Phyre Job Id

Job DescriptionP10903
Confidence2.65%DateThu Jan 5 11:32:22 GMT 2012
Rank53Aligned Residues24
% Identity33%Templatec2ov2O_
PDB info PDB header:protein binding/transferaseChain: O: PDB Molecule:serine/threonine-protein kinase pak 4; PDBTitle: the crystal structure of the human rac3 in complex with the crib2 domain of human p21-activated kinase 4 (pak4)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.. ......
Predicted Secondary structure 

















......





Query SS confidence 

















. . . . . .





Query Sequence  SAPERATGAVITDWRPED. . . . . . PAFWQQ
Query Conservation                 
  ......      
Alig confidence 

















......





Template Conservation 
 
 

 
  




  

 
 


  
  
Template Sequence  SAPSNFEHRVHTGFDQHEQKFTGLPRQWQS
Template Known Secondary structure 











TTTTS

GGGTT
Template Predicted Secondary structure 












Template SS confidence 





























   12.......20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions