Return to main results Retrieve Phyre Job Id

Job DescriptionP00448
Confidence27.47%DateThu Jan 5 10:56:37 GMT 2012
Rank82Aligned Residues22
% Identity23%Templatec2fy2A_
PDB info PDB header:transferaseChain: A: PDB Molecule:choline o-acetyltransferase; PDBTitle: structures of ligand bound human choline acetyltransferase2 provide insight into regulation of acetylcholine synthesis
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.. .......20.....
Predicted Secondary structure 








.........







Query SS confidence 








. . . . . . . . .












Query Sequence  TLPSLPYAY. . . . . . . . . DALEPHFDKQTME
Query Conservation   

 


  .........  


 

   
 
Alig confidence 








.........












Template Conservation   

 



 
  

 


 
  

 
 

  
Template Sequence  GLPKLPVPPLQQTLATYLQCMRHLVSEEQFR
Template Known Secondary structure 
S






GGGS
Template Predicted Secondary structure 











Template SS confidence 






























   12.......20.........30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions