Return to main results Retrieve Phyre Job Id

Job DescriptionP33030
Confidence92.91%DateThu Jan 5 11:51:08 GMT 2012
Rank445Aligned Residues60
% Identity22%Templatec3hu2C_
PDB info PDB header:transport proteinChain: C: PDB Molecule:transitional endoplasmic reticulum atpase; PDBTitle: structure of p97 n-d1 r86a mutant in complex with atpgs
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.........50.........60.........70.........80...
Predicted Secondary structure 
































..
Query SS confidence 













































































. .
Query Sequence  LITGFLGSGKTTSILHLLAHKDPNEKWAVLVNEFGEVGIDGALLADSGALLKEIPGGCMCCVNGLPMQVGLNTLLRQG. .
Query Conservation 













  

         


 

 
   

  

      
 

  




     
   
  
    ..
Alig confidence 




















..........................






























..
Template Conservation 

 

 




 
   

   ..........................      
    
     
     
   
  
  
Template Sequence  LLYGPPGTGKTLIARAVANET. . . . . . . . . . . . . . . . . . . . . . . . . . GAFFFLINGPEIMSKLAGESESNLRKAFEEAEK
Template Known Secondary structure 
STTSS
..........................SSTS
TT
Template Predicted Secondary structure 






..........................









Template SS confidence 















































































   242.......250.........260.. .......270.........280.........290.....
 
   84.....90.
Predicted Secondary structure  .



Query SS confidence  .







Query Sequence  . KPDRLLIE
Query Conservation  .  
 



Alig confidence  .







Template Conservation    
 

 

Template Sequence  NAPAIIFID
Template Known Secondary structure  SSS
Template Predicted Secondary structure 



Template SS confidence 








   296...300....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions