Return to main results Retrieve Phyre Job Id

Job DescriptionP77014
Confidence23.88%DateThu Jan 5 12:25:26 GMT 2012
Rank2Aligned Residues29
% Identity21%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.
Predicted Secondary structure 



Query SS confidence 






































Query Sequence  VSADFFGLSFAQYASVMISVDAAAIAATLIMLYLFFRRV
Query Conservation 

    

 
  
   
 

 
  
      
  


  
Alig confidence 









..........


















Template Conservation   







 ..........    
          



Template Sequence  FIAGIYGYPV. . . . . . . . . . VLAVMGVIAVIMVVYFKKK
Template Known Secondary structure  TTS


..........TTTTS
Template Predicted Secondary structure  ..........
Template SS confidence 






































   306...310..... ....320.........330....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions