Return to main results Retrieve Phyre Job Id

Job DescriptionP25747
Confidence3.04%DateThu Jan 5 11:42:35 GMT 2012
Rank33Aligned Residues32
% Identity25%Templated3ehbb2
SCOP infoTransmembrane helix hairpin Cytochrome c oxidase subunit II-like, transmembrane region Cytochrome c oxidase subunit II-like, transmembrane region
Resolution2.32

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   337..340.........350.........360... .....
Predicted Secondary structure 




..........
Query SS confidence 


























. . . . . . . . . .




Query Sequence  LLAFVIPVWLANILFSVIWLRYFRQGP. . . . . . . . . . VEWLW
Query Conservation                 
  
      

..........

   
Alig confidence 


























..........




Template Conservation   
   
 
 
   
       
            
  




Template Sequence  YIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIW
Template Known Secondary structure  SSTTTSSS






Template Predicted Secondary structure 












Template SS confidence 









































   40.........50.........60.........70.........80.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions