Return to main results Retrieve Phyre Job Id

Job DescriptionP77808
Confidence85.40%DateThu Jan 5 12:33:01 GMT 2012
Rank33Aligned Residues48
% Identity17%Templatec1z0zC_
PDB info PDB header:transferaseChain: C: PDB Molecule:probable inorganic polyphosphate/atp-nad kinase; PDBTitle: crystal structure of a nad kinase from archaeoglobus2 fulgidus in complex with nad
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60.........
Predicted Secondary structure 

















Query SS confidence 



































































Query Sequence  LKVEMLSTGDEVLHGQIVDTNAAWLADFFFHQGLPLSRRNTVGDNLDDLVTILRERSQHADVLIVNGG
Query Conservation 
   

 

 


 
   


   
   
   
  
     
 
    
  

       
 

 


Alig confidence 






.........





























...........










Template Conservation 

  

 .........
       
   
                 ...........   
 

 


Template Sequence  MRAAVVY. . . . . . . . . KTDGHVKRIEEALKRLEVEVELFNQPSEEL. . . . . . . . . . . ENFDFIVSVGG
Template Known Secondary structure 
.........SSSSTTTT
SS

GGG...........GGSSSS
Template Predicted Secondary structure 
.........









...........





Template SS confidence 



































































   1...... ..10.........20.........30....... ..40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions