Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF61
Confidence4.23%DateWed Jan 25 15:20:33 GMT 2012
Rank39Aligned Residues29
% Identity31%Templated1yt3a2
SCOP infoSAM domain-like HRDC-like RNase D C-terminal domains
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50
Predicted Secondary structure 











Query SS confidence 



































Query Sequence  DYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQL
Query Conservation 



































Alig confidence 



.











......












Template Conservation 
 
 .

   
 

  
......   

   

 

Template Sequence  DMPG. YRKAFKAIKSLI. . . . . . TDVSETHKISAEL
Template Known Secondary structure  GSTT.......T

Template Predicted Secondary structure 



.......



Template SS confidence 



































   299300.. .......310.... .....320.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions