Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF61
Confidence3.65%DateWed Jan 25 15:20:33 GMT 2012
Rank47Aligned Residues25
% Identity20%Templated1knxa1
SCOP infoMurF and HprK N-domain-like HprK N-terminal domain-like HPr kinase/phoshatase HprK N-terminal domain
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   40.........50.........60.........70..
Predicted Secondary structure 












Query SS confidence 
































Query Sequence  VADEYGIPRQLNENSFAITTSLAASEIEDLIRL
Query Conservation 
































Alig confidence 







........
















Template Conservation   
    

........

 
   
   
  
  
Template Sequence  VNQTYQVP. . . . . . . . ILKTDFFSTELSFTVET
Template Known Secondary structure  GGGT


........SS
GGGGTTT
Template Predicted Secondary structure 


........


Template SS confidence 
































   102....... 110.........120......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions