Return to main results Retrieve Phyre Job Id

Job DescriptionP42906
Confidence22.54%DateThu Jan 5 12:02:04 GMT 2012
Rank140Aligned Residues68
% Identity21%Templatec3gg7A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized metalloprotein; PDBTitle: crystal structure of an uncharacterized metalloprotein from2 deinococcus radiodurans
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90.........100.........110........
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  HPAAMSLCCCCAKERIVLITDAMQAAGMPDGRYTLCGEEVQMHGGVVRTASGGLAGSTLSVDAAVRNMVELTGVTPAEAI
Query Conservation   
  
             



    
   
        
    
        



   
   
             

Alig confidence 




















..









......................
























Template Conservation             
 



 


.. 
        ......................  
          
    
  
   
Template Sequence  TQKGAALIRSMPRDRVLTETD. . GPFLELDGQA. . . . . . . . . . . . . . . . . . . . . . ALPWDVKSVVEGLSKIWQIPASEVE
Template Known Secondary structure  SS
GGG


..TTTSTT......................

GGGTS
Template Predicted Secondary structure 







..









......................





Template SS confidence 















































































   174.....180.........190.... .....200.... .....210.........220.........
 
   119120.........130
Predicted Secondary structure 
Query SS confidence 











Query Sequence  HMASLHPARMLG
Query Conservation    

 


  
 
Alig confidence 











Template Conservation   
   

 

 
Template Sequence  RIVKENVSRLLG
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 











   230.........240.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions