Return to main results Retrieve Phyre Job Id

Job DescriptionP76658
Confidence47.10%DateThu Jan 5 12:25:18 GMT 2012
Rank155Aligned Residues34
% Identity21%Templatec3vh3A_
PDB info PDB header:metal binding protein/protein transportChain: A: PDB Molecule:ubiquitin-like modifier-activating enzyme atg7; PDBTitle: crystal structure of atg7ctd-atg8 complex
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.. .......60.........70
Predicted Secondary structure 






















.



Query SS confidence 















































.

















Query Sequence  LPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIEERPGG. AANVAMNIASLGANARLV
Query Conservation          




   

    
   

 

 
 

          

.




  

 

  
 

Alig confidence 












................................


.

















Template Conservation   
 
   





................................ 
 

  

  
   


 
 
Template Sequence  LDIIKNTKVLLLG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AGTLGCYVSRALIAWGVRKITF
Template Known Secondary structure  T

................................
STT

Template Predicted Secondary structure 



................................




Template SS confidence 


































































   319320.........330. ........340.........350...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions