Return to main results Retrieve Phyre Job Id

Job DescriptionP76658
Confidence39.50%DateThu Jan 5 12:25:18 GMT 2012
Rank177Aligned Residues33
% Identity24%Templatec1zfnA_
PDB info PDB header:transferaseChain: A: PDB Molecule:adenylyltransferase thif; PDBTitle: structural analysis of escherichia coli thif
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.........50.. .......60.........70
Predicted Secondary structure 






















.



Query SS confidence 














































.

















Query Sequence  PEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIEERPGG. AANVAMNIASLGANARLV
Query Conservation         




   

    
   

 

 
 

          

.




  

 

  
 

Alig confidence 











................................


.

















Template Conservation    
    




................................ 




 
   

  


 
 
Template Sequence  QKLLDSQVLIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LGGLGTPAALYLAGAGVGTLVL
Template Known Secondary structure 

................................
STTTT
S
Template Predicted Secondary structure 


................................




Template SS confidence 

































































   24.....30..... ....40.........50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions