Return to main results Retrieve Phyre Job Id

Job DescriptionP76658
Confidence41.69%DateThu Jan 5 12:25:18 GMT 2012
Rank172Aligned Residues30
% Identity40%Templatec1jrxA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:flavocytochrome c; PDBTitle: crystal structure of arg402ala mutant flavocytochrome c32 from shewanella frigidimarina
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50.... .....60.........70
Predicted Secondary structure 






















.



Query SS confidence 













































.















Query Sequence  ERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIEERPGGAA. NVAMNIASLGANARLV
Query Conservation      




   

    
   

 

 
 

          



.


  

 

  
 

Alig confidence 








................................




.















Template Conservation 
  





................................

 


 


 

  
  
 

Template Sequence  DTVDVVVVG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SGGAGFSAAISATDSGAKVILI
Template Known Secondary structure 
S
................................
STT

Template Predicted Secondary structure 


................................




Template SS confidence 






























































   125....130... ......140.........150.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions