Return to main results Retrieve Phyre Job Id

Job DescriptionP76658
Confidence42.59%DateThu Jan 5 12:25:18 GMT 2012
Rank171Aligned Residues45
% Identity24%Templatec1j6uA_
PDB info PDB header:ligaseChain: A: PDB Molecule:udp-n-acetylmuramate-alanine ligase murc; PDBTitle: crystal structure of udp-n-acetylmuramate-alanine ligase2 murc (tm0231) from thermotoga maritima at 2.3 a resolution
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.... .....60.........70.........80.........
Predicted Secondary structure 



















..







Query SS confidence 










































. .


































Query Sequence  GVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIEERPGGAA. . NVAMNIASLGANARLVGLTGIDDAARALSKSLADV
Query Conservation   




   

    
   

 

 
 

          



..


  

 

  
 


 

 
  
  
   
   
Alig confidence 





................................




..













.....















Template Conservation 

   
................................ 

 
 
 

  
   
  
 .....  
         
   
Template Sequence  KIHFVG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . IGGIGXSAVALHEFSNGNDVY. . . . . GSNIEETERTAYLRKL
Template Known Secondary structure  T................................TTSTT
.....
SS

T
Template Predicted Secondary structure  ................................






.....




Template SS confidence 















































































   2..... ..10.........20........ .30.........40....
 
   90...
Predicted Secondary structure 



Query SS confidence 



Query Sequence  NVKC
Query Conservation 


 
Alig confidence 



Template Conservation 
  
Template Sequence  GIPI
Template Known Secondary structure  T

Template Predicted Secondary structure 

Template SS confidence 



   45...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions