Return to main results Retrieve Phyre Job Id

Job DescriptionP76235
Confidence6.58%DateThu Jan 5 12:21:00 GMT 2012
Rank91Aligned Residues27
% Identity44%Templated2cp8a1
SCOP infoRuvA C-terminal domain-like UBA-like UBA domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........
Predicted Secondary structure 









Query SS confidence 



































Query Sequence  FIDRRLNGKNKSMVNRQRFLRRYKAQIKQSISEAIN
Query Conservation   



     

  
  
        

  
   
 
Alig confidence 






.........



















Template Conservation 
 

 

.........
 

 

  

   
 



Template Sequence  FCDRQLN. . . . . . . . . LRLLKKHNYNILQVVTELLQ
Template Known Secondary structure 


.........TTTTT
Template Predicted Secondary structure 


.........




Template SS confidence 



































   21...... ..30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions