Return to main results Retrieve Phyre Job Id

Job DescriptionP76235
Confidence7.12%DateThu Jan 5 12:21:00 GMT 2012
Rank85Aligned Residues29
% Identity31%Templatec3dmaA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:exopolyphosphatase-related protein; PDBTitle: crystal structure of an exopolyphosphatase-related protein2 from bacteroides fragilis. northeast structural genomics3 target bfr192
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   98.100.........110.........120.........130...
Predicted Secondary structure 

















Query SS confidence 



































Query Sequence  SGSGQGQASQDGEGQDEFVFQISKDEYLDLLFEDLA
Query Conservation   
 
     
   


    


 

  




 

Alig confidence 









.......


















Template Conservation 




  


.......  
              
 
Template Sequence  NGGGHLNASG. . . . . . . GEFYGTXEEAVKVFEQALE
Template Known Secondary structure  S

SS.......
S
Template Predicted Secondary structure 






.......

Template SS confidence 



































   307..310...... ...320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions