Return to main results Retrieve Phyre Job Id

Job DescriptionP76235
Confidence6.55%DateThu Jan 5 12:21:00 GMT 2012
Rank92Aligned Residues32
% Identity28%Templatec3cs5B_
PDB info PDB header:photosynthesisChain: B: PDB Molecule:phycobilisome degradation protein nbla; PDBTitle: nbla protein from synechococcus elongatus pcc 7942
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   119120.........130.........140.........150.........160
Predicted Secondary structure 
















Query SS confidence 









































Query Sequence  ISKDEYLDLLFEDLALPNLKQNQQRQLTEYKTHRAGYTANGV
Query Conservation 

 

  




 



 
  
    
        
    
 
Alig confidence 













..........

















Template Conservation 













..........

















Template Sequence  ISREDLEDLFIEVV. . . . . . . . . . RQKMAHENIFKGMIRQGS
Template Known Secondary structure 

..........TTTTSTTTT

Template Predicted Secondary structure  ..........

Template SS confidence 









































   28.30.........40. ........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions