Return to main results Retrieve Phyre Job Id

Job DescriptionP76235
Confidence6.19%DateThu Jan 5 12:21:00 GMT 2012
Rank100Aligned Residues25
% Identity24%Templatec2vofA_
PDB info PDB header:apoptosisChain: A: PDB Molecule:bcl-2-related protein a1; PDBTitle: structure of mouse a1 bound to the puma bh3-domain
Resolution1.8 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   315....320.........330.........340........ .350.
Predicted Secondary structure 










.


Query SS confidence 

































.


Query Sequence  TIVSSALKLMDEVVKERYNPAQWNIYAAQASDGD. NWA
Query Conservation 
 




  
  
    
 
   
 
    



.
  
Alig confidence 















..........

..



.


Template Conservation       
   
  

 
..........

.. 

 



Template Sequence  ESIDTARIIFNQVXEK. . . . . . . . . . EF. . EDGIINWG
Template Known Secondary structure 
S............TT



Template Predicted Secondary structure 

............





Template SS confidence 





































   62.......70....... .. 80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions