Return to main results Retrieve Phyre Job Id

Job DescriptionP76692
Confidence1.61%DateThu Jan 5 12:25:19 GMT 2012
Rank72Aligned Residues27
% Identity48%Templatec2p5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:putative transcriptional regulator peza; PDBTitle: molecular and structural characterization of the pezat chromosomal2 toxin-antitoxin system of the human pathogen streptococcus pneumoniae
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10 .........20.........30..
Predicted Secondary structure  ............
Query SS confidence 




. . . . . . . . . . . .





















Query Sequence  WILTS. . . . . . . . . . . . LVMTFFGIPILAQFLAVVIAML
Query Conservation 




............















 




Alig confidence 




............





















Template Conservation 






































Template Sequence  WILMSDDLSDLIHTNIYLVETFDEIERYSGYLDGIERML
Template Known Secondary structure  TTTGGG

S
Template Predicted Secondary structure 




Template SS confidence 






































   111........120.........130.........140.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions