Return to main results Retrieve Phyre Job Id

Job DescriptionP76323
Confidence6.46%DateThu Jan 5 12:21:50 GMT 2012
Rank23Aligned Residues33
% Identity15%Templatec2wl8D_
PDB info PDB header:protein transportChain: D: PDB Molecule:peroxisomal biogenesis factor 19; PDBTitle: x-ray crystal structure of pex19p
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30..... ....40.......
Predicted Secondary structure 



...........
Query SS confidence 




















. . . . . . . . . . .











Query Sequence  RSDVQGGYRVYGSWMAENVQD. . . . . . . . . . . QVSILNQKLSEF
Query Conservation 







 


 

 


 
...........





  

  
Alig confidence 




















...........











Template Conservation 






  


 


 
  


 

  

 

   
  
   
Template Sequence  YPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQF
Template Known Secondary structure  TTTS
Template Predicted Secondary structure 





Template SS confidence 











































   189190.........200.........210.........220.........230..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions