Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB89
Confidence15.00%DateThu Jan 5 11:14:54 GMT 2012
Rank35Aligned Residues26
% Identity23%Templatec2xgvA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:psiv capsid n-terminal domain; PDBTitle: structure of the n-terminal domain of capsid protein from2 rabbit endogenous lentivirus (relik)
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   150.........160.........170.........180..
Predicted Secondary structure 














Query SS confidence 
































Query Sequence  LIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGK
Query Conservation 
   
   
     


 



 
 
 
 
 
 
Alig confidence 












.......












Template Conservation 


 


 
 


.......
 
  
 
 

  
Template Sequence  LGAYLEERAREWD. . . . . . . AQPQQPLPYTSAH
Template Known Secondary structure  .......TSS
SS
SS
Template Predicted Secondary structure  .......









Template SS confidence 
































   6970.........80. ........90....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions