Return to main results Retrieve Phyre Job Id

Job DescriptionP06612
Confidence23.13%DateThu Jan 5 10:59:12 GMT 2012
Rank261Aligned Residues37
% Identity19%Templatec1u6gA_
PDB info PDB header:ligaseChain: A: PDB Molecule:cullin homolog 1; PDBTitle: crystal structure of the cand1-cul1-roc1 complex
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   479480.........490 .........500.........510.....
Predicted Secondary structure 

...................










Query SS confidence 











. . . . . . . . . . . . . . . . . . .
























Query Sequence  EASLVKELEKRG. . . . . . . . . . . . . . . . . . . IGRPSTYASIISTIQDRGYVRVENR
Query Conservation 





 

  
...................







 

  
  
 

    
Alig confidence 











...................
























Template Conservation   
 





  
 
    
   
   
   
      

  

 






 

  
Template Sequence  QAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDG
Template Known Secondary structure  TSSSTTT



TTSTT
Template Predicted Secondary structure 
















Template SS confidence 























































   711........720.........730.........740.........750.........760......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions