Return to main results Retrieve Phyre Job Id

Job DescriptionP76122
Confidence1.64%DateThu Jan 5 12:19:14 GMT 2012
Rank95Aligned Residues40
% Identity25%Templatec3k93A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:phage related exonuclease; PDBTitle: crystal structure of phage related exonuclease (yp_719632.1) from2 haemophilus somnus 129pt at 2.15 a resolution
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70.........80.........90....
Predicted Secondary structure 

















Query SS confidence 




















































Query Sequence  HYPIKKAYTPYNIHTYKTEEVVNQMNIKVKNMTLDEINNTYCNNDYYNQAIRE
Query Conservation 




















































Alig confidence 













..













...........











Template Conservation   

   




 
 ..

 
    
  
  ........... 

 

 
 
 
Template Sequence  QIPQIRRITTVIIQ. . RDNELIDKIKERVS. . . . . . . . . . . AAQKYYDQLISE
Template Known Secondary structure  TS
GGGG..

...........
Template Predicted Secondary structure 




..
...........
Template SS confidence 




















































   181........190.... .....200........ .210.........220
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions