Return to main results Retrieve Phyre Job Id

Job DescriptionP76122
Confidence2.06%DateThu Jan 5 12:19:14 GMT 2012
Rank72Aligned Residues31
% Identity23%Templatec2wn8A_
PDB info PDB header:transferaseChain: A: PDB Molecule:adp-ribosyltransferase enzymatic component; PDBTitle: structural basis for substrate recognition in the enzymatic2 component of adp-ribosyltransferase toxin cdta from3 clostridium difficile
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   80........ .90.... .....100.........110
Predicted Secondary structure 





..............








Query SS confidence 








. .





. . . . . . . . . . . .















Query Sequence  NTYCNNDYY. . NQAIRE. . . . . . . . . . . . EPIDLLDRSFSSSSWP
Query Conservation 








..





............















Alig confidence 








..





............















Template Conservation    

   
  

  

           

  
  




 



 
Template Sequence  NDYMRGGYTAINNYLISNGPVNNPNPELDSKITNIENALKREPIP
Template Known Secondary structure  TTTTS

S


Template Predicted Secondary structure 












Template SS confidence 












































   251........260.........270.........280.........290.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions