Return to main results Retrieve Phyre Job Id

Job DescriptionP76122
Confidence3.45%DateThu Jan 5 12:19:14 GMT 2012
Rank27Aligned Residues31
% Identity48%Templatec2nrrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:uvrabc system protein c; PDBTitle: crystal structure of the c-terminal rnaseh endonuclase2 domain of uvrc
Resolution1.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70.........80.........90.........100.........110
Predicted Secondary structure 


























Query SS confidence 


































































Query Sequence  PIKKAYTPYNIHTYKTEEVVNQMNIKVKNMTLDEINNTYCNNDYYNQAIREEPIDLLDRSFSSSSWP
Query Conservation 


































































Alig confidence 










..............................


..




....











Template Conservation    
  



 
..............................

 ..  
 
....

 

     

Template Sequence  PKKGDYRRYKI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DDY. . ESIRT. . . . VVKRRYSKHPLP
Template Known Secondary structure 
GGG

..............................
......TTS


Template Predicted Secondary structure 







..............................
......





Template SS confidence 


































































   388.390........ .400. ..... ...410........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions