Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9H1
Confidence5.14%DateThu Jan 5 11:10:11 GMT 2012
Rank39Aligned Residues42
% Identity10%Templatec3cxoA_
PDB info PDB header:lyaseChain: A: PDB Molecule:putative galactonate dehydratase; PDBTitle: crystal structure of l-rhamnonate dehydratase from2 salmonella typhimurium complexed with mg and 3-deoxy-l-3 rhamnonate
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.... .....30.........40.........50.........60.........70..
Predicted Secondary structure 




......























Query SS confidence 











. . . . . .















































Query Sequence  VFCGINPGLSSA. . . . . . GTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDR
Query Conservation 



  

  
 ......  
  
  
 
 

  
   
             
    
 
 


  
Alig confidence 











......



















..................









Template Conservation   


 

  

 

  
        
  
    




..................






 

Template Sequence  FIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCV. . . . . . . . . . . . . . . . . . DLALWDLFGK
Template Known Secondary structure  TTSBTT
TTTSTTST..................
Template Predicted Secondary structure 










..................
Template SS confidence 

































































   103......110.........120.........130.........140 .........150
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions