Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8U6
Confidence9.08%DateThu Jan 5 11:08:46 GMT 2012
Rank23Aligned Residues32
% Identity25%Templatec3idwA_
PDB info PDB header:endocytosisChain: A: PDB Molecule:actin cytoskeleton-regulatory complex protein sla1; PDBTitle: crystal structure of sla1 homology domain 2
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90........
Predicted Secondary structure 











Query SS confidence 








































Query Sequence  LCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGI
Query Conservation 







 





 



 


 




 

  


 

Alig confidence 













.........

















Template Conservation     


  
   

.........   

 

    

 


Template Sequence  NCQRYTINFDREQL. . . . . . . . . TEDMMPDINNSMLRTLGL
Template Known Secondary structure  TT
.........
GGGGGG

TT
Template Predicted Secondary structure 

.........






Template SS confidence 








































   18.20.........30. ........40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions