Return to main results Retrieve Phyre Job Id

Job DescriptionP41407
Confidence88.46%DateThu Jan 5 12:01:28 GMT 2012
Rank74Aligned Residues61
% Identity23%Templatec3u80A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:3-dehydroquinate dehydratase, type ii; PDBTitle: 1.60 angstrom resolution crystal structure of a 3-dehydroquinate2 dehydratase-like protein from bifidobacterium longum
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 




























Query SS confidence 















































































Query Sequence  MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDEL
Query Conservation 
 




 



   
 
  
                
   

    
                                
Alig confidence 











.

.















..












...........................





Template Conservation 
  








.
 .

  
       
  
..
      


 

...........................



 
Template Sequence  MTKVIVVNGPNL. RQ. DLDTLRKLCAEWGKDL. . GLEVEVRQTDDEA. . . . . . . . . . . . . . . . . . . . . . . . . . . EMVRWM
Template Known Secondary structure 

S

.
.T..T
S
...........................
Template Predicted Secondary structure 





.

.

..




...........................
Template SS confidence 















































































   1........10.. .. .....20.........30 .........40... ......
 
   81........90..
Predicted Secondary structure 

Query SS confidence 











Query Sequence  IAELKAHDVIVI
Query Conservation     
  

 

 
Alig confidence 











Template Conservation    
    




Template Sequence  HQAADEKTPVVM
Template Known Secondary structure  T

Template Predicted Secondary structure 



Template SS confidence 











   62.......70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions