Return to main results Retrieve Phyre Job Id

Job DescriptionP41407
Confidence46.31%DateThu Jan 5 12:01:28 GMT 2012
Rank133Aligned Residues33
% Identity18%Templatec3kd9B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:coenzyme a disulfide reductase; PDBTitle: crystal structure of pyridine nucleotide disulfide oxidoreductase from2 pyrococcus horikoshii
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40..
Predicted Secondary structure 













Query SS confidence 









































Query Sequence  MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRD
Query Conservation 
 




 



   
 
  
                
   
Alig confidence 














.........

















Template Conservation 









 


 .........

  
        
 


Template Sequence  LKKVVIIGGGAAGMS. . . . . . . . . AASRVKRLKPEWDVKVFE
Template Known Secondary structure 



S.........
TTS
Template Predicted Secondary structure 




.........



Template SS confidence 









































   3......10....... ..20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions