Return to main results Retrieve Phyre Job Id

Job DescriptionP67095
Confidence32.40%DateWed Jan 25 15:21:00 GMT 2012
Rank87Aligned Residues27
% Identity19%Templatec2eklA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:d-3-phosphoglycerate dehydrogenase; PDBTitle: structure of st1218 protein from sulfolobus tokodaii
Resolution1.77 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30...
Predicted Secondary structure 













Query SS confidence 
































Query Sequence  MMKLMFASDIHGSLPATERVLELFAQSGAQWLV
Query Conservation 



 






   

   
        
 

Alig confidence 










......















Template Conservation   




     ......      
   
 

  
Template Sequence  TVKALITDPID. . . . . . EILIKTLREKGIQVDY
Template Known Secondary structure 


S


......TT
Template Predicted Secondary structure 




......


Template SS confidence 
































   5....10..... ....20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions