Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFS9
Confidence32.39%DateThu Jan 5 11:27:10 GMT 2012
Rank114Aligned Residues32
% Identity34%Templatec2ghiD_
PDB info PDB header:transport proteinChain: D: PDB Molecule:transport protein; PDBTitle: crystal structure of plasmodium yoelii multidrug resistance2 protein 2
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   373......380....... ..390.........400.........
Predicted Secondary structure 





..............











Query SS confidence 














. . . . . . . . . . . . . .





















Query Sequence  KVKRGDRIALSGNTG. . . . . . . . . . . . . . RSTGPHLHYEVWINQQAVNPLT
Query Conservation   
  

 

  



.............. 










  
  



 
Alig confidence 














..............



.....












Template Conservation   
  

   
 
 








  
 
     
..... 
   
       
Template Sequence  FIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEG. . . . . DIKIGGKNVNKYN
Template Known Secondary structure 
TT

STTSSTTSS

.....TTGGGS
Template Predicted Secondary structure 















.....









Template SS confidence 


















































   42.......50.........60.........70.... .....80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions